PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10026557m
Common NameCICLE_v10026557mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 190aa    MW: 20919.3 Da    PI: 11.1176
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10026557mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.85.9e-293590156
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                     k+r+ W+ eLH+ F++a+++LGGse+AtPk i+++m+v+gLt++++kSHLQkYR +
  Ciclev10026557m 35 KQRRSWSAELHQLFLQALSHLGGSEVATPKLIKKIMNVDGLTNDEIKSHLQKYRAH 90
                     79****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2843292IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-253392IPR009057Homeodomain-like
SuperFamilySSF466893.58E-173393IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-253590IPR006447Myb domain, plants
PfamPF002493.0E-83788IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MNLGFYNSMS NGRQPNLHSR LQNLQKRRRW LNRKKQRRSW SAELHQLFLQ ALSHLGGSEV  60
ATPKLIKKIM NVDGLTNDEI KSHLQKYRAH LRSPSNNSSS GQDNHPRIAN VQVGNSSNSS  120
ILQCGSSKSQ IHVPSSSANT ISMSGGNRVV AEEDARSDGH SWNGAVSSTY AMNFAQTDLS  180
GNQPINIKI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425832.11e-137hypothetical protein CICLE_v10026557mg
RefseqXP_006466649.21e-136PREDICTED: uncharacterized protein LOC102610013
TrEMBLV4SES11e-137V4SES1_9R
STRINGVIT_07s0197g00060.t013e-32(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3323522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-23G2-like family protein